SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 361100.BCQ_3316 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  361100.BCQ_3316
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.54e-29
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 5.36e-23
Family PKD domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 361100.BCQ_3316
Sequence length 971
Comment (Bacillus cereus Q1)
Sequence
MKGYSKKVLVGVSFASFMLGSFQGDALAEGTKGEQVSYRNVLKMEPIGLQLPVQELAHSS
KVLENKSFEKRLKFADLSQRPPEVKKESKQLAVAKTYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNKDSLAFYQNDSRMQAIIDKLNQQGQAYTKDDSKGIETLVEVLRSGFYLGFY
HTELSKLNERSYHDKCLPALKTIANNSNFKLGTLEQNRVVSSYGKLIGNASSDVETITSA
AKIFKQYNDNFSTLVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPEDTIWYQKIDSYIN
ELSRFALIGTVTAKNGWLINNGIYYTGRLGTFHSTETKGLQVVTDAMKIYPYLGEQYFVA
AEQIATNYGGKDANGKVVDLDQIREDGKKKYLPKTYTFDDGAIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNPDDVLTMVVYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKMYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGISSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKIHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNREKYNVPLVSDDYLA
THAPKPVSDIAAEITAEAKLSNVSVKKNKSQFFHTFTLQGTYTGTTAKGEYEDWKTITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNAAGQFEYDVVFHGINTEEGAVNKAPVAVING
SYSGNVNAAISFKSDGSKDEDGKIVAYKWEFGDGTVSNEQNPTHVYTKEGTYTAKLTVTD
DKGLTNTATTNVTVQKKEDNSVEKEPNNSFQTANKLQFNQVLRASLGNGDTSDYFEINVE
TAKNLQINVTKENNIGVNWVLYSEADLNNYVTYAQQEGNKLVGSYYTYPGKYYLHVYQYG
GGTGNYTVEVK
Download sequence
Identical sequences B9ITQ0
361100.BCQ_3316 WP_000679536.1.10762 WP_000679536.1.13024 WP_000679536.1.20687 WP_000679536.1.24184 WP_000679536.1.29209 WP_000679536.1.33045 WP_000679536.1.3318 WP_000679536.1.3615 WP_000679536.1.37093 WP_000679536.1.37990 WP_000679536.1.44463 WP_000679536.1.49428 WP_000679536.1.50316 WP_000679536.1.50514 WP_000679536.1.54775 WP_000679536.1.54782 WP_000679536.1.56055 WP_000679536.1.57203 WP_000679536.1.57815 WP_000679536.1.57859 WP_000679536.1.58814 WP_000679536.1.60274 WP_000679536.1.64377 WP_000679536.1.70645 WP_000679536.1.77690 WP_000679536.1.81088 WP_000679536.1.82533 WP_000679536.1.84337 WP_000679536.1.93932 WP_000679536.1.95457 WP_000679536.1.95484 gi|222096976|ref|YP_002531033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]