SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5DTH4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5DTH4
Domain Number 1 Region: 51-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.92e-22
Family BAR domain 0.052
Further Details:      
 
Domain Number 2 Region: 322-373
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-21
Family SH3-domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36914.A5DTH4
Sequence length 374
Comment (Lodderomyces elongisporus)
Sequence
MNSELTKLTNQVCKKWKSVGDVVTKPNCHQVDWKAIKHTPQYLKLKIKYAGVSYTVDEDF
DKLENILKSQSVSLKKLIEQTKQFTSSMVDTIQNAIAVSKCFHDTIDPCSNAHSNVPIFG
DTYDKWANMVKYKQLVQAISIESEIVYLNNGTLKQLELLNNQILKQVFKMIRERRYAALD
CDKLSNEHKTLAEKQSNIGGADQLSSRETSHIFAIGRKLFDAKKKYNYYNALLKKELPSL
ILLIKPIISYATTDLYLLHLNYCYSWIIKLNNIPYKDVPMEKLLRDSETKQVELDAEVRG
LKLFTPMQKDGHTVCTQTNASWSCIALYDYDGLQDDDLTFKRNDTIKIIAKDNDNWWKGE
VKGKVGYFPSNYVF
Download sequence
Identical sequences A5DTH4
XP_001528140.1.59662 36914.A5DTH4 LELT_00660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]