SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5DTW4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5DTW4
Domain Number 1 Region: 4-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-37
Family Calponin-homology domain, CH-domain 0.000067
Further Details:      
 
Domain Number 2 Region: 356-423
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000000000103
Family EB1 dimerisation domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36914.A5DTW4
Sequence length 439
Comment (Lodderomyces elongisporus)
Sequence
MVIGESRTELLHWLNTVLDLNYTKVEQCGTGAAFCQLMDSIVGNVPLNKVKFGAKSDYES
RHNWKILQQEFTKHKINKHMDVEKLIKCRLQDNLELLQWFKRYWNEHKDLNVPYDAQASR
RRILSSSSSSNSNSYSSPSLLATTSNTRTVGLSPHTSTRLASSGPGSIRQVSAPLAQQLQ
NMSNKGSARVLSNSKTYRSSPTTTNNSAHSSNSSYTTANDGVASSNYSSSNLSLSNKVRT
RKSTTPVTSRVTTPVNQRPKRFSSATEYEKRVSLHNGGNGSSYQQETLGEAPHIRKQTEL
DTSGGTMHIYNNEESNQDSDESNDKGVGVSIDGDEDGQILIAQQSKEIEVLVEENNELKL
HLSEYRVSCDTLQTERNFYFNKLRDIELLIQNIQADPSIVEKLDVLTLTAQVEKLLYKTE
EGFSDQTSNHDMVLDTESF
Download sequence
Identical sequences A5DTW4
XP_001528280.1.59662 36914.A5DTW4 LELT_00800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]