SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_Genewise1_v1.C_1460036 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_Genewise1_v1.C_1460036
Domain Number 1 Region: 94-207
Classification Level Classification E-value
Superfamily TPR-like 5.55e-26
Family Tetratricopeptide repeat (TPR) 0.0011
Further Details:      
 
Domain Number 2 Region: 184-274
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000336
Family Thioltransferase 0.027
Further Details:      
 
Domain Number 3 Region: 5-86
Classification Level Classification E-value
Superfamily TPR-like 0.0000949
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_Genewise1_v1.C_1460036
Sequence length 274
Comment (Populus trichocarpa)
Sequence
MCRTEALLKLHQLEDAQYCLSKVPKLESYAIYSQTRFFGMLSEAYPFLVQAQIEMALGRF
ENGVAAAEKAGQIDPRNVEVAVLLNNVRLVARARIRGNDLFKSERFTEACSAYGEGLRLD
PSNSVLYCNRAACWFKRGLWERSIDDCNQALSIQPNYTKALLRRAASNSKLERWADAVRD
YEVLRRELPDDNGVAESLFHAQVALKKSRGEEVYNMKFGGGVEEVLGLEQFRAAISLPGV
SVVHFKSSSHLHCKQISPFVDTLCVRYPSLNFLK
Download sequence
Identical sequences 3694.estExt_Genewise1_v1.C_1460036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]