SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00031704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00031704
Domain Number 1 Region: 179-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.07e-34
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 85-177
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5e-23
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 
Domain Number 3 Region: 44-82
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000201
Family ECR1 N-terminal domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00031704
Sequence length 320
Comment (Populus trichocarpa)
Sequence
MRGIEISLNQTQKIRLQRALKQLESLYLRANFNASVTVADTIPVSNEDTILKGHGTSERD
GEVVATLCGVVERVNKLVYVRTLRARYKPEIGDIIVGRVVEVAQKRWKLEINFSQDAVLM
LSSMNLPDGLQRRRTALDELNMRSIFEENDVVCGEVRNFQNDGGIQLQARSQKYGKLEKG
QLLTIPPYLVKRQKHHFHHLEQYGVDLILGCNGFIWVGEHVEARDCIVEDQLNNTEQQFT
KSNTTKEMPLETRRSICQIANAIRVLSILGFNVTLEVILETIDLSSTLNLGIDEMLGPEF
HVLVAEREAERRTSMTKRKG
Download sequence
Identical sequences B9GX78
POPTR_0003s19390.1|PACid:18217116 3694.eugene3.00031704 XP_002303939.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]