SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00120370 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00120370
Domain Number 1 Region: 230-371
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.74e-34
Family Thioltransferase 0.00031
Further Details:      
 
Domain Number 2 Region: 100-210
Classification Level Classification E-value
Superfamily TPR-like 6.48e-23
Family Tetratricopeptide repeat (TPR) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00120370
Sequence length 373
Comment (Populus trichocarpa)
Sequence
MDAAKITELKHFIDQCKTCPSILHSPSLVFFKGARVPPETKPEKGDINMSDSGECYDSKR
PIEDDDDDIVESDIDLDNTDVVEPDNDPPQKMGDPAVEVTEEKRDAAQTEKAKAMDAISE
GNLDEAIDHLTEAIMLNPISAILYATRASVFVKLKKPHAAIRDADAALVINPDSAKGYKV
RGMARAMLGQWEQAASELQMASKLDYDDEIGSVLKKVEPNARKIEEHRIKYERLQKEREL
RKAERERKQEAEPQEREALSALNEGQVIGIHSARELDPKLNAASKTSRLAILYFTATWCG
PCRMISPIFTSLAAKYPKVVFLKVDIDEARDVASSWNISSVPTFYFTKNGKEIDKVVGAD
KNGLERKIEQHAG
Download sequence
Identical sequences 3694.eugene3.00120370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]