SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_LG_I000384 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_LG_I000384
Domain Number 1 Region: 64-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000118
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_LG_I000384
Sequence length 227
Comment (Populus trichocarpa)
Sequence
MASDLPCILYFFFFLLFPSSLVAQRNGNATVGDSLIAGDEATLWLSPAEDFAFGFRQLDK
KDLYLLAIWYNKIPDKTIVWYANGDRPAPKMLNNPQGGEIWKSGPNNGEAAYGFMNDTGN
FLVANANGEKLWQSFELLTDTLLPTQIMEKGGILSSRLSETNFSQGRFQFRLIQDGNAVL
NTINLPTGFPYEAYFWSNTVDSNSSNAGYQVVFNESGYLYVLRASNK
Download sequence
Identical sequences 3694.fgenesh4_pg.C_LG_I000135 3694.fgenesh4_pg.C_LG_I000384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]