SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_LG_III001640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_LG_III001640
Domain Number 1 Region: 116-233,333-444,802-1022
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.97e-112
Family Calcium ATPase, transmembrane domain M 0.0013
Further Details:      
 
Domain Number 2 Region: 449-468,606-866
Classification Level Classification E-value
Superfamily HAD-like 2.11e-53
Family Meta-cation ATPase, catalytic domain P 0.00019
Further Details:      
 
Domain Number 3 Region: 456-661
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.49e-48
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0032
Further Details:      
 
Domain Number 4 Region: 234-328
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-24
Family Calcium ATPase, transduction domain A 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_LG_III001640
Sequence length 1047
Comment (Populus trichocarpa)
Sequence
MEQYLKENFVVDAKRPSEQALRRWRSAVSVVRNPRRRFRMVADLAKRAEAERKRKNLQEK
IRIALYVNKAALHFIEAAKVVEHKLSDNVRQTGFGIGPDELAALARSHDINDLESHGGVE
GLAREVSASLNDGVVSSDISLRQNIYGFNRYAEKPARSFWMFVWDALHDLTLVILMVCAV
VSIGVGIATDGWPNGMYDGVGIVICILLVVMVTAITDYKQALQFKVLDKEKKNVIVQVTR
EGIRQKVSIFDLVVGDVVHLSIGDLVPADGILISGHSLSVDESSLSGESELVDINKKRPF
LLSGTKIQDGSGKMLVTAVGMRTEWGTLMVHLSEVDQDETPLQVKLNGVATIIGKIGLAF
AVITFLVLLVRFLLVKADHHEITKWSSSDALKLLNFFSISVTIIVVAVPEGLPLAVTLSL
AFAMKKLMHDRALVRHLSACETMGSVCCICTDKTGTLTTNHMVVNKIWICEETKSIQTNS
NKDLLMSSFSENVHGILLQSIFQNTGSEVTKGKDGRDNILGTPTETAILEFGLILGGEFK
TYHNESEIVKVEPFNSEKKKMSVLVSLPNNGGFRAFCKGASEIILKMCDKMLTADGKAVP
LSEKQRQKITDVINGFACEALRTLCLAFKDMENTSGANSMPDNNYTLIAVVGIKDPIRPE
VKEAVKTCLDAGITVRMVTGDNINTAKAIARECGILTDYGLVIEGADFRCKSPQELEEII
PNLQVMARSSPSDKHKLVTQLRSVFKEVVAVTGDGTNDAPALAEADIGLAMGIAGTEVAK
ESADVIVMDDNFKTIVNVARWGRSVYINIQKFVQFQLTVNVAALMINFISAIRLSLNSPF
QDACDEPLTTVQLLWVNLIMDTLGALALATEPPHDGLMKRPPIGRNVNIITKTMWRNIIG
QSIYQISVLVILQLDGKHLLKLSDSDDTKILNTFIFNTFVLCQVFNEINSRDMEKINVFK
GIFSSWIFLAVMFSTVTFQIVIVEFLGTYANTVPLRWELWLASVLIGAASLVISVILKCI
PVGTNKDDNTAKHHDGYEPLPSGPDMA
Download sequence
Identical sequences B9GWB2
POPTR_0003s20280.1|PACid:18217975 XP_002304770.1.11743 3694.fgenesh4_pg.C_LG_III001640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]