SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.XV.1130.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.XV.1130.1
Domain Number 1 Region: 235-377
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.93e-34
Family Thioltransferase 0.00033
Further Details:      
 
Domain Number 2 Region: 104-218
Classification Level Classification E-value
Superfamily TPR-like 4.02e-22
Family Tetratricopeptide repeat (TPR) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.XV.1130.1
Sequence length 379
Comment (Populus trichocarpa)
Sequence
MDAAKVTELKHFIDQCKANPSIIHTPSLAFFKTYLQSLGARFPPETKSKGDIDMADSGEY
SDSKRPIEDDDEIVESDIDLDNTDVVEPDNHPPQKMGDPAVEVTEEKRDAAKTEKSKAMD
AISEGKLEEAIDHLTEAITLNPTSAILYATRGSVFVKLKKPLAAIRDADAALAINLNSAK
GYKVRGMARAILGQWEQAATDLHEASKLDYDDEIGLVLKKVEPNARKIEEHRRKYERLRK
ERELKKAELERKQQAEAQVSEREALSALKEGQVIGIHSAKELDPKLNAASRTSRLAILYF
TASWCGPCRMIAPIFTSLAAKYLKVVFLKVDIDEARDVAARWNISSVPTFYFIKNGKEID
KVVGADKNELERKVKQHSG
Download sequence
Identical sequences 3694.gw1.XV.1130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]