SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G10490.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3702.AT1G10490.1-P
Domain Number - Region: 218-322,369-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00109
Family Tandem AAA-ATPase domain 0.053
Further Details:      
 
Domain Number - Region: 610-642
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0208
Family N-acetyl transferase, NAT 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G10490.1-P
Sequence length 1028
Comment (Arabidopsis thaliana)
Sequence
MRKKVDERIRTLIENGVKLRHRSMFVIIGDKARDQIVNLHHILSKSVVKSNPSVLWCYKN
RLDISSHNKKRAKQLKKMKERGQLDPEKLDAFSLFLDVVDVTHCLYKDSERILGNTFGIC
ILQDFEALTPNLLARTIETVEGGGLVVLLLQSLASLTSLCTMVMDVHDRFRTESHSEASG
RFNERFLLSLASCKACVVMDDELNLLPLSSHIKSITKVPTKEDSEALSEAERDLKSLKDA
LNDDFPVGPLINKCCTLDQGKAVVTFFDAILDKTLRSIVALIASRGRGKSAALGLAVAGA
VAAGYSNIYVTAPSPDNLKTVFEFVCKGFDALEYKEHLEYDVVRSVNPEFNKAIVRINIF
KQHRQTIQYIQPHEHEKLSQVELLVIDEAAAIPLPVVKSLLGPYLVFLSSTVSGYEGTGR
SLSLKLLQQLEEQSRAPVTGVEGSLSGCLFKKIELSESIRYASGDPIESWLNGLLCLDVA
NCLPNPACHPLPSQCDLYYVNRDTLFSYHKDSELFLQRMMALCVSSHYKNSPNDLQLLSD
APAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRKSAEKSLREGHSPHGDQIPWKFC
EQFRDVVFPKLSGARIVRIAVHPNAMKMGYGSAAVELLTRYFEGQLASISEGDDELEVEP
SPVRVTEAAAKVSLLEEQIKPRANLPPLLVPLRDRRPERLHYIGVSFGLTLDLFRFWRKH
KFAPFYISQIPSAVTGEHTCMLLKPLTLSNDEFEVDESDELGFFAPFYKDFRIRFSKLLS
DKFKKMDYKLAMSVLNPKINFPEVDLTGNSPDGFLKKLDGVLSPYDMERFRAYTANLVDF
NLVYDICKTLAHHYFQEKLPVSLSYVQASVLLCLGLQESDFSSIERQMQLERGQIYSLLL
KVGKKLYKYLNGIATKELESTLPRLKDRVLEPHKVSVDEDLREGAKEVEEQMRARIEELL
DPELLDQFAIGDKEAEALQKSKISSSGLISIESTKTDNKKEKPSGFDKSAKKRGNDKHSS
TSNKKRRA
Download sequence
Identical sequences Q9XIK4
3702.AT1G10490.1-P At1g10490___KOG2036 AT1G10490.1 AT1G10490.1 NP_001318971.1.80155 NP_172519.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]