SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G72360.2-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT1G72360.2-P
Domain Number 1 Region: 74-133
Classification Level Classification E-value
Superfamily DNA-binding domain 1.5e-22
Family GCC-box binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G72360.2-P
Sequence length 262
Comment (Arabidopsis thaliana)
Sequence
MCGGAVISDYIAPEKIARSSGKSSWRSNGVFDCSIYDFDGNFDELESDEPFVFSSTHKHH
ASGSASDGKKKQSSRYKGIRRRPWGRWAAEIRDPIKGVRVWLGTFNTAEEAARAYDLEAK
RIRGAKAKLNFPNESSGKRKAKAKTVQQVEENHEADLDVAVVSSAPSSSCLDFLWEENNP
DTLLIDTQWLEDIIMGDANKKHEPNDSEEANNVDASLLSEELLAFENQTEYFSQMPFTEG
NCDSSTSLSSLFDGGNDMGLWS
Download sequence
Identical sequences A0A178W8F1 F4IDA7
GO.4500 NP_001077812.1.80155 3702.AT1G72360.2-P AT1G72360.2 AT1G72360.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]