SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT3G13230.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT3G13230.1-P
Domain Number 1 Region: 122-211
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.1e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT3G13230.1-P
Sequence length 215
Comment (Arabidopsis thaliana)
Sequence
MAESTQMEVETATEGTVPLPPKPTFKPLKAHEMSDGKVQFRKIAVPPNRYSPLKKAWLDI
YTPIYDQMKVDIRMNLKARKVELKTRADTPDISNLQKSADFVHAFMLGFDIPDAISLLRM
DELYVESFEIKDVKTLKGEHLSRAIGRLSGKGGKTKFAIENSTKTRIVIADTRIHILGAF
SNIKVARSSLCSLIMGSPAGKVYSKLRSVSARLNE
Download sequence
Identical sequences A0A178V9R4 Q9LTU6
GO.12759 AT3G13230.1 At3g13230___KOG3273 NP_001326485.1.80155 NP_566450.1.80155 3702.AT3G13230.1-P AT3G13230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]