SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT3G23230.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT3G23230.1-P
Domain Number 1 Region: 19-78
Classification Level Classification E-value
Superfamily DNA-binding domain 1.18e-23
Family GCC-box binding domain 0.0000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT3G23230.1-P
Sequence length 139
Comment (Arabidopsis thaliana)
Sequence
MESSNRSSNNQSQDDKQARFRGVRRRPWGKFAAEIRDPSRNGARLWLGTFETAEEAARAY
DRAAFNLRGHLAILNFPNEYYPRMDDYSLRPPYASSSSSSSSGSTSTNVSRQNQREVFEF
EYLDDKVLEELLDSEERKR
Download sequence
Identical sequences Q9LTC5
NP_188964.2.80155 AT3G23230.1 3702.AT3G23230.1-P AT3G23230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]