SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT3G44730.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT3G44730.1-P
Domain Number 1 Region: 378-742
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.4e-117
Family Motor proteins 0.000000993
Further Details:      
 
Domain Number 2 Region: 9-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-21
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3702.AT3G44730.1-P
Sequence length 1087
Comment (Arabidopsis thaliana)
Sequence
MDQGAMETLPEKPSEDEFSLALRNGLILCNVLNKVNPGSVLKVVENPITPAIQYADGAAQ
SAIQYFENMRNFLKAVEDMQLLTFGASDLEKGGSSNKVVDCILCLKGFYEWKQAGGVGVW
RYGGTVRIVSFNRKGSSPPQYGIGSESTTDESVSLDESESSQYDQLLDFLHLSNEISAEE
SETAISLAFLFDHFALQLLHGYLKESDGINDMPLNEMVIDTLLNRVVKDFSAILVSQGAQ
LGSFLRKILKCDNGDLSRSEFLAAVFRYLQHRKDLVSKEFSKFCKCGGKLEFSRLNAREF
SPGHVEAIGLQQKELEEVKSNFVETRSQVKQMQSEWQKELQRIVHHVKAMEVTSSSYHKV
LEENRLLYNEVQDLKGTIRVYCRVRPFFQEQKDMQSTVDYIGENGNIIINNPFKQEKDAR
KIFSFNKVFGQTVSQEQIYIDTQPVIRSVLDGFNVCIFAYGQTGSGKTYTMSGPDLMTET
TWGVNYRALRDLFQLSNARTHVVTYEIGVQMIEIYNEQVRDLLVSDGSSRRLDIRNNSQL
NGLNVPDANLIPVSNTRDVLDLMRIGQKNRAVGATALNERSSRSHSVLTVHVQGKELASG
SILRGCLHLVDLAGSERVEKSEAVGERLKEAQHINKSLSALGDVIYALAQKSSHVPYRNS
KLTQVLQDSLGGQAKTLMFVHINPEVNAVGETISTLKFAQRVASIELGAARSNKETGEIR
DLKDEISSLKSAMEKKEAELEQLRSGSIRNTTECQRARAVSPFHLPRTGNGAGTKAEASP
QPNDGTRSYETRSCSTGKQRKSGFPSALRNREASPRMPNLAEERLNPSPSRRSLSTDRAS
TIKSRNKPDVTQNLPVSRTPFPARVPVVKSFSTVPLNPSAENNHRLHTDNSSEAFQNHQK
LSARKLFPEIEEEHIRHALHIRQGGVKKTRAESSKAKAKQPSPARFQKLDVGISLRSDAD
SEAKVGNYQTQKGNNNHNVIHSRFQNFDVGISLFSDLCAGDKSDSTLKSDSSETDNEPPS
KSKNAQRNSSKNSLNHKLRTIYAHEDTSLVDDKPSNGTAHIKEGNNNISMPEFRRSRSTH
HARFMVP
Download sequence
Identical sequences Q8W1Y3
NP_001319684.1.80155 NP_190059.3.80155 AT3G44730.1 3702.AT3G44730.1-P AT3G44730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]