SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT4G29110.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3702.AT4G29110.1-P
Domain Number - Region: 90-122
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0981
Family GCC-box binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3702.AT4G29110.1-P
Sequence length 200
Comment (Arabidopsis thaliana)
Sequence
MESSVPKRGLYMEMEQNAQVAAKRLWKVVRIVFCVLKTGTVKNKLMLDLNLMLKRGNKAI
TNLRRRSSSTGSHDVSSSSRVRDYDPFAFISKRKRRVHGGYDNEEDAVEAAVKKVFELLG
ENDKKTVATESARESPLIMSPAVRQLRVTDSPFPLDDGGDHDHVVDKAAEEFIKKFYKNL
KLQKKMTNALESPYHDGWVR
Download sequence
Identical sequences A0A178V0H4 Q9SZE0
NP_194640.1.80155 AT4G29110.1 3702.AT4G29110.1-P AT4G29110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]