SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT5G64610.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT5G64610.1-P
Domain Number 1 Region: 170-441
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.29e-110
Family N-acetyl transferase, NAT 0.0000000291
Further Details:      
 
Domain Number 2 Region: 52-170
Classification Level Classification E-value
Superfamily Chromo domain-like 6.96e-24
Family Chromo barrel domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3702.AT5G64610.1-P
Sequence length 445
Comment (Arabidopsis thaliana)
Sequence
MGSSADTETAMIIATPASNHNNPATNGGDANQNHTSGAILALTNSESDASKKRRMGVLPL
EVGTRVMCQWRDGKYHPVKVIERRKNYNGGHNDYEYYVHYTEFNRRLDEWIKLEQLDLDS
VECALDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELG
KYEIETWYFSPFPPEYNDCVKLFFCEFCLSFMKRKEQLQRHMRKCDLKHPPGDEIYRSST
LSMFEVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDRGCHMVGYFSKE
KHSEEAYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLVSYRGYW
TRILLDILKKHKGNISIKELSDMTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRH
LKAAGRGGLDVDVSKMIWTPYKEQS
Download sequence
Identical sequences Q9FLF7
AT5G64610.1 AT5G64610.1 NP_201266.1.80155 3702.AT5G64610.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]