SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 373903.Hore_10180 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  373903.Hore_10180
Domain Number 1 Region: 231-334
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.48e-19
Family ATP-dependent protease Lon (La), catalytic domain 0.0051
Further Details:      
 
Domain Number 2 Region: 137-223
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-16
Family PDZ domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 373903.Hore_10180
Sequence length 337
Comment (Halothermothrix orenii H 168)
Sequence
MTENKGLIKSNAVKLFIAIIILFIIVNLVPTKYYVMSPGIAQELSPIITVKGGHKGVTSG
DFMLTAVASHRATLFDIIYISLKKPRGIEIESVEEQLPPGMDMDGYLEIMANLMEESKLH
AQAVAFKKLGYRVKVEGKGAEIVEVLPEGSAGNVLKKGDIIVGIDGKEVSFATDAVKLIR
KHNIGEEVKLKVLRGKEVMHFRVKTVELKNSPGKASIGVLITTRDLSYYFPKKVIFNTKN
IVGPSAGAMFTLEIYNQLIPEDITKGRRIAGTGTISLDGHIGKIDGVTQKVMAAERAGAD
LFLSPAKNYSEAKKAARRIKVVKVNNIDEAIRYLKNN
Download sequence
Identical sequences B8CWV5
gi|220931861|ref|YP_002508769.1| 373903.Hore_10180 WP_012635959.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]