SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374833.NMCC_0722 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374833.NMCC_0722
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.8e-50
Family Ribonuclease PH domain 1-like 0.000018
Further Details:      
 
Domain Number 2 Region: 293-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-48
Family Ribonuclease PH domain 1-like 0.0000135
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-28
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 451-545
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-26
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 5 Region: 555-635
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.18e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 609-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.24e-20
Family Cold shock DNA-binding domain-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 374833.NMCC_0722
Sequence length 706
Comment (Neisseria meningitidis 053442)
Sequence
MFDKHVKTFQYGNHTVTLETGEIARQAAAAVKVSMGDTVVLVAVTTNKEVKEGQDFFPLT
VDYLERTYAAGKIPGGFFKREGKQSEKEILTSRLIDRPIRPLFPEGFYHDIQIVAMVVSV
DPEIDSDIPAMLGASAALVLSGVPFAGPIGAARVGYINGVYVLNPTKAELAKSQLDLVVA
GTSKAVLMVESEAKILPEDVMLGAVVYGHDQMQAAINAINEFADEVNPEVWDWKAPETNE
ELVAKVRGIAGETIKEAFKIRQKQARSAKLDEAWNAVKEALITEETDTLAANEIKGIFKH
LEADVVRSQILDGQPRIDGRDTRTVRPLNIQTGVLPRTHGSALFTRGETQALAVATLGTS
RDEQIIDALSGEYTDRFMLHYNFPPYSTGEVGRVGAPKRREIGHGRLAKRALLAVLPKPE
DFSYTMRVVSEITESNGSSSMASVCGGCLSLLSAGVPLKAHVAGIAMGLILEGNKFAVLT
DILGDEDHLGDMDFKVAGTTEGVTALQMDIKIQGITKEIMQIALAQAKEARLHILDQMKA
AVAGPQELSAHAPRLFTMKINQDKIREVIGKGGETIRSITAETGTEINIAEDGTITIAAT
TQEAGDAAKKRIEQITAEVEVGKVYEGTVVKILDNNVGAIVSVMPGKDGLVHISQIAHER
VRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKALLDAPAREENAAE
Download sequence
Identical sequences A9M3J0
gi|161869702|ref|YP_001598869.1| 374833.NMCC_0722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]