SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374847.Kcr_1417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374847.Kcr_1417
Domain Number 1 Region: 7-99
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000000000536
Family Prefoldin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 374847.Kcr_1417
Sequence length 106
Comment (Candidatus Korarchaeum cryptofilum OPF8)
Sequence
MSSDEYLQAKAEEILAELNQVLVQLATLRAEYNSVDEAIRRLERLPEADEIFERVGVLYI
RRDRDSVLLDLKATKETLEATIKSLEKKERDLRETLSRVASSTQSS
Download sequence
Identical sequences B1L6T4
WP_012310060.1.97847 gi|170291030|ref|YP_001737846.1| 374847.Kcr_1417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]