SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374847.Kcr_1424 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374847.Kcr_1424
Domain Number 1 Region: 10-349
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.58e-52
Family tRNA pseudouridine synthase TruD 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 374847.Kcr_1424
Sequence length 359
Comment (Candidatus Korarchaeum cryptofilum OPF8)
Sequence
MEVPPIDSHLGMLTYMSGGSPINGRLREKLSDFIVDEVLLGKRASRAFLGIDKFEGGGVS
YLVVMKRVRMDSFEMISKLSKKLGRRVGYAGMKDARSISFQFISVQGSLRELPEMEGLSL
RYAGRGEMIYLGMNDGNHFTVVIRGADTIELPKIFPNFFSYQRFGVKRPYNHEIGKAILL
RDIEGASSMISEQGYEVSAARSLKQLSEMIGSELIRFYVHSYQSYIFNLILSRRIELGID
PRHGDFVLRPNGEIALYPERGSLLLPLVGGLTEARGWLAEELASILREEGVSKEMFIFRE
LPEVSALGDFRKAFCEVEPKIVEREGFIVLSFFLESGAYATSYLREIIKPRDPIAQGFI
Download sequence
Identical sequences B1L6U1
374847.Kcr_1424 WP_012310067.1.97847 gi|170291037|ref|YP_001737853.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]