SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374930.CGSHiEE_03970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374930.CGSHiEE_03970
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily CAC2185-like 3.01e-86
Family CAC2185-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 374930.CGSHiEE_03970
Sequence length 196
Comment (Haemophilus influenzae PittEE)
Sequence
MNKCQRFFINRSLQRKLTNQGMTVISANCVGAFILHDLHQPFNSPFVNLCLSPQDFLRYL
QNMDFYRTQPLTFVQTEKSYPVGKLADLEIHFMHYHSEQEANEKWQLRTSRMKLDNLFIM
MTDRDGVTEKDIQLFDQLPFKNKVIFTHKPYPAFKSACYIKGFEKQNQVGDIFEFSSWNG
KKYYDQFDYVKWFNQA
Download sequence
Identical sequences gi|148825839|ref|YP_001290592.1| 374930.CGSHiEE_03970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]