SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374931.CGSHiGG_01790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374931.CGSHiGG_01790
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily CAC2185-like 8.76e-88
Family CAC2185-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 374931.CGSHiGG_01790
Sequence length 206
Comment (Haemophilus influenzae PittGG)
Sequence
MNPFQKIKSAVNKCQRFFINRTLQHKLINQGMTVISANCVGAFILHDLHQPFNSPFVNLY
LSPQDFLRYLQNIDFYLTQPLTFVQTEKSYPVGKLADLEIHFMHYHSEQEANEKWQLRTS
RMKLDNLFIMMTDRDGVTEKDIQLFDQLPFKNKVIFTHKPYPAFKSAYYIKGFEKQNQVG
HIFEFSGWNGKKYYDQFDYVKWFNQA
Download sequence
Identical sequences A0A1Q5Y321 A5UF61
WP_012054681.1.45125 374931.CGSHiGG_01790 gi|148827047|ref|YP_001291800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]