SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374931.CGSHiGG_03775 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374931.CGSHiGG_03775
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-50
Family Ribonuclease PH domain 1-like 0.0000126
Further Details:      
 
Domain Number 2 Region: 291-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-45
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-31
Family Ribonuclease PH domain 2-like 0.00082
Further Details:      
 
Domain Number 4 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.33e-28
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 5 Region: 553-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.17e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 619-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.22e-21
Family Cold shock DNA-binding domain-like 0.000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 374931.CGSHiGG_03775
Sequence length 709
Comment (Haemophilus influenzae PittGG)
Sequence
MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVTVVAKKDVKEGQDFFPLTV
NYQERTYAAGKIPGGFFKREGRPSEGETLIARLIDRPIRPLFPEGFFNEIQVVATVVSVN
PQISPDLVAMIGASAALTLSGVPFNGPIGAVRVGFIDNQFVLNPTMAEQKQSRLDLVVAG
TDKAVLMVESEADILTEEQMLAAVVFGHQQQQVVIEAIKEFAKEAGKPRWDWVAPQPNTD
LINKVKAIAEARLGDAYRITEKQLRYEQIDAIKADVIAQITAEDEEINEGKIVDIFTALE
SQIVRGRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQALAVATLGTERD
AQIIDELTGERQDHFLFHYNFPPYSVGETGMIGSPKRREIGHGRLAKRGVAAVMPSLAEF
PYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEEEKFVVLSDI
LGDEDHLGDMDFKVAGTREGVTALQMDIKIEGITPEIMQIALNQAKSARMHILGVMEQAI
PAPRADISDYAPRIYTMKIDPKKIKDVIGKGGATIRSLTEETGTSIDIDDDGTVKIAAVD
SNAAKNVMGRIEEIVAEVEAGAIYKGKVTRLADFGAFVAIVGNKEGLVHISQIAEERVEK
VSDYLQVGQEVNVKVVEIDRQGRIRLTMKDLAPKQETEINQEDSVEEQE
Download sequence
Identical sequences A0A1Q5Y2F9 A5UG34
374931.CGSHiGG_03775 WP_012054891.1.45125 gi|148827370|ref|YP_001292123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]