SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 375286.mma_0181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  375286.mma_0181
Domain Number 1 Region: 7-368
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.01e-105
Family O-acetyltransferase 0.0000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 375286.mma_0181
Sequence length 385
Comment (Janthinobacterium Marseille)
Sequence
MTSIGIVSPQSMFFDTPLPLQSGAQITDYTLVYETYGTLNADHSNAVLVCHALNASHHVA
GTYSEDAGTTGWWDNMVGPGKPLDTNKYFVIGVNNLGSCFGSTGPMHINPATGKQYGAHF
PVVTVEDWVQSQARLADALGIKQFAAVMGGSLGGMQALAWSILFPERLRHCVVIASTPKL
TAQNIAFDDVARQAILTDPDYHGGDFYAHGVVPKNGLRVARMLGHITYLSDDDMAAKFGR
ELRSGSYQFGFGIDFEIESYLRYQGDKFSTYFDANTYLLITKALDYFDPAKDFGGDLTKT
LSNTRAKFLLVSFTTDWRFSPERSHEMVQALVNNNRTVTYAEIDAPHGHDAFLLDDQRYM
NVVRSYFERAYEEIDGGSLKAGASA
Download sequence
Identical sequences A6SUC4
WP_011979407.1.39695 375286.mma_0181 gi|152980347|ref|YP_001351871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]