SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 382640.Btr_0671 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  382640.Btr_0671
Domain Number 1 Region: 44-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-37
Family DsbA-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 382640.Btr_0671
Sequence length 218
Comment (Bartonella tribocorum CIP 105476)
Sequence
MIKYRSFLFFGIIFLFITIVQNSVAVALARGIKPVATVDMAELLQSGKVKDRVEGEADAP
VIIVEYASLTCTHCAHFYNDILPQIRKKYIKTGKVKMIFRDYAFDPRATAGFMLARCAPE
DRYFPLIEVLFQKQNEWVWGKDALTPLKKISLMAGFTDESFTACLKNQTILDEVNASFER
GKELGVSATPTFFINGDKYEGAMKVEEFFSLIDSYLKN
Download sequence
Identical sequences A9IQV5
382640.Btr_0671 WP_012231210.1.76171 WP_012231210.1.90605 gi|163867896|ref|YP_001609100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]