SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 386415.NT01CX_1295 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386415.NT01CX_1295
Domain Number 1 Region: 866-976
Classification Level Classification E-value
Superfamily Collagen-binding domain 2.88e-28
Family Collagen-binding domain 0.00038
Further Details:      
 
Domain Number 2 Region: 747-858
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000000209
Family Collagen-binding domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 386415.NT01CX_1295
Sequence length 977
Comment (Clostridium novyi NT)
Sequence
MKRKMLKLMCNLIAVGLVSSSLSVNVLAVDNIQNNIVVSRENTINKKYSIGELEKLSNEK
LIDTLSKIKWNDITDFMQYNDGARKFYSDYSRVQAIINAIKERGSQYTEENDKGIPTLIE
VLRAGFYLGFYNKQLSDFDSIKYKERCIPAINSVINNSNFKLGTPCQNEIIKSVGLLISN
TTCDEKIVNKLTPILVQYNSNVDENVKDYTKGQAIYNIIEGVSYSIESYLDKSNVKVDNT
VWFKNIDGFINEVSKLSLINNITDDNEWLIDNGIYYSGRLAKAHSDMRVPQKTLEKALEV
YPYLSDHYLKAVETIAYKFNGTKLDGSKIDLSNIKEEAKKKYTPKTYKFDNGSVVIKAGD
KVSEEKIKRLYWASKEVKAQFHRVIGSDNPLEKGHPDDILNIVIYNNPKEYKVNTILYGY
STDNGGIYIENKGTFFTYERTEKDSIFSLEELFRHEFTHYLQGRYLVPGMWGVSDFYKGN
NCRLTWFEEGSAEFFAGATRKDNILPRKSEVKGISWSPERRFSVTKLLHSQYGSFDFYNY
GFAFNDYIYNNKKDILNNLVNYIKQNDVKGYESYIEKLSARENLNKKYQNHMQKLFENYD
NLTTPLVSDDYLKEHPNKTSKEVYSDIEKTCNLKDIKISEEKGEFFNTFTLRGTYEKSTS
NDEMQDWNDMNNLCNKFLNDLEKLNWSGYKTLTCYFVNPRVNKLGNLEYDIVFHGILKDE
VHVTDNKKDPDTKSSKDVKEDGKTINERKSEVKNGSSFEDAIGPIKSNNILGTLKENYKQ
IYYFNIDKPTDIDINLENKSNEKIAWKVYSEENIDDCIGYPNINGKFLNGKIHVSKKGKY
YLVVYKYSKETVDYNFKIDGLNDEEMVAESEPNNCFEQANKLKLGDTILGEVSKNDYMDI
YTFDIKDKREVSINLSKLGSGEINWLVFSANDLTNYKFYALKNGNNMSNKFITEPGKYYI
SVYKISENGGKYSLSIK
Download sequence
Identical sequences A0PYC6
WP_011721386.1.12664 WP_011721386.1.66291 386415.NT01CX_1295 gi|118443201|ref|YP_877378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]