SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 387092.NIS_1791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387092.NIS_1791
Domain Number 1 Region: 17-363
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.19e-27
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 387092.NIS_1791
Sequence length 376
Comment (Nitratiruptor SB155-2)
Sequence
MKIIVAFLCIVLTVFAHEKVFVVERENSALAVIENHKLKNEIKNMHNFNHAVVKFIENDG
YVITRDGYLIKFDPIHEKKIAEVQASKSAIGFTLAKDFIAVANYANKTVEIFDRDLHHLQ
TINTGSRNVGIKTYKDYLVFAAMDSDSIWVMKKVVRTYFDQYGTPRQKLFFQKVKIVQNA
GEVPFDAMINKNLYVVGFFNSPFVGVLNLDTFEYKQVPLKLEKRTMVLKVPHFGFWSIMK
DKFFIPAVGDNKVFVFDKDFHFIKAIEVEGNPVFTSLSPDRRFLAVTFSGKKFPIVQIVD
TTDLQVIKRFDFGGMVLHVRWSKEEPLLYVSNNGLSKVIGMDTKKWKKSFEVAVPKPSGI
FIFDMRQGNRLKEALQ
Download sequence
Identical sequences A6Q5Y7
WP_012083159.1.54627 387092.NIS_1791 gi|152991531|ref|YP_001357253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]