SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391037.Sare_1926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391037.Sare_1926
Domain Number 1 Region: 80-286
Classification Level Classification E-value
Superfamily Prim-pol domain 3.14e-29
Family Bifunctional DNA primase/polymerase N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391037.Sare_1926
Sequence length 377
Comment (Salinispora arenicola CNS-205)
Sequence
MAARWLGASKILGRPVASNDPYPHICGRLLPAERAHSHRPVLLQRRDCAACAHGRHQRRR
ATPDIPPAVMERTRTMSDNPLLNAALGHAARGWRVFPLRPDDKRPAFPDHPADDCTGRDP
RCRNAGCHLGWEPRATTDPDRIRRAWTARPYGIGLACGPSHLVVVDLDVPKDDSGGGPSG
TDTLAALASQHGASIDATYTVTTGRGGTHLYYRHPDGGPDLRNTAGTLGPMVDTRAHGGY
VVAAGSTAAGRPYTVSLDTDPAPLPAWLAGLLAPAPLPPQRPVVVELPGGRERSYVRAAV
ERECASVTGAPDHHNDALYFASIALGQLVAGGSLSADEASTALEHAGLSVGLRHRAVLAT
IASGFRAGTRRPRTVAA
Download sequence
Identical sequences A8LYU8
WP_012182115.1.69805 gi|159037549|ref|YP_001536802.1| 391037.Sare_1926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]