SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 392021.A1G_05470 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392021.A1G_05470
Domain Number 1 Region: 80-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.17e-23
Family Translational machinery components 0.00071
Further Details:      
 
Domain Number 2 Region: 9-77
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.46e-19
Family Ribosomal S5 protein, N-terminal domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 392021.A1G_05470
Sequence length 176
Comment (Rickettsia rickettsii Sheila Smith)
Sequence
MSKVKKNDETLSEVLVDVNRVTKVVKGGRSFAFSAYVVVGDKAGRVGAGHGKAKEVNEAR
GKAKQAAKKRMMKVPLYQNRTIHHDVVGKSGAAKVILRRAKAGTGVIAGGSMRAIFDSLG
IHDVVAKSIGSTNVYAMISATFDALNKLASPKSIAMRRDKKVNEISVKSADIQVNE
Download sequence
Identical sequences A8GT52 B0BUP3
gi|379019466|ref|YP_005295700.1| gi|157828843|ref|YP_001495085.1| WP_012151140.1.17801 WP_012151140.1.31136 WP_012151140.1.3339 WP_012151140.1.38731 WP_012151140.1.4490 WP_012151140.1.74071 WP_012151140.1.76853 WP_012151140.1.77680 WP_012151140.1.78650 WP_012151140.1.81845 WP_012151140.1.83836 WP_012151140.1.89241 gi|379016087|ref|YP_005292322.1| gi|379018152|ref|YP_005294387.1| gi|378721666|ref|YP_005286553.1| gi|165933570|ref|YP_001650359.1| gi|378723013|ref|YP_005287899.1| gi|378724367|ref|YP_005289251.1| 392021.A1G_05470 452659.RrIowa_1180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]