SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 392500.Swoo_0909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392500.Swoo_0909
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.53e-42
Family SMI1/KNR4-like 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 392500.Swoo_0909
Sequence length 133
Comment (Shewanella woodyi ATCC 51908)
Sequence
MHDIIEQLQEMSETVPIPLELPTFDQLVMAEEEILMPLPGELKQYLLYASDVIYGSLEPV
TVSDPNSHTFLPEVTAYAWSIGMPREYVAVCQQGNSFYCIDQEGQMLLWNEDGSESEYWE
SLWEWVEQVWMKS
Download sequence
Identical sequences B1KFN7
WP_012323550.1.77901 gi|170725272|ref|YP_001759298.1| 392500.Swoo_0909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]