SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 392500.Swoo_1074 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  392500.Swoo_1074
Domain Number - Region: 33-121
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00373
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 392500.Swoo_1074
Sequence length 183
Comment (Shewanella woodyi ATCC 51908)
Sequence
MKATCFNSIYAALILIGLATPVLAQEIFSPSVDKSGNISFPADYRSTMEHLGSWFVPTGG
ASGFHHVYTEMESVEYFQKNGVFPDGAVLVKELLVSEANNYTTGEGVHSANGEYKQWFVM
VKDSQNRFTDNPVWGDGWGWALFKPGNTSKNLATDYKKDCLACHVPAKGTDWIYTQAYPA
LSE
Download sequence
Identical sequences B1KGN9
gi|170725436|ref|YP_001759462.1| WP_012323713.1.77901 392500.Swoo_1074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]