SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 392500.Swoo_3041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392500.Swoo_3041
Domain Number 1 Region: 139-564
Classification Level Classification E-value
Superfamily Subtilisin-like 5.13e-100
Family Subtilases 0.00000000000369
Further Details:      
 
Domain Number 2 Region: 695-806
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-23
Family Proprotein convertase P-domain 0.023
Further Details:      
 
Domain Number 3 Region: 48-135
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000147
Family Subtilase propeptides/inhibitors 0.0049
Further Details:      
 
Domain Number 4 Region: 594-671
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000981
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 392500.Swoo_3041
Sequence length 807
Comment (Shewanella woodyi ATCC 51908)
Sequence
MTSTKPKTVALSLSALAMAISASVSAAPAFTPGVQSLNSGIEQASPLPKRYIVKFRNSNA
AASFQSQSNEMNEALYEPRSNEVFSHHRAMNSVSAKEMKRIGRSNSYTAKLNSKGIQSLR
LRPDVEYVEEDVPRRLLSETTPWGQTYVGATSLSDSQAGNRTICIIDSGYDRDHSDLSGN
NVTGTNNSGTGNWYDPGNNNAHGTHVAGTIAAIANNSGVVGVMPNQNANIHVIKVFNESG
WGYSSSLVSAIDTCVNNGANVVTMSLGGSSSSTTERNALNAHESNGVLLIAAAGNDGDNT
HSYPASYDAVMSVAAVDSNKDHAAFSQYTNQVEISGPGEAILSTVTAGEGRLADITVGGQ
SYFDQGVVPHNRYVKSGTNHVPTPVIGNVTAELAECTVSGTTFNCGNMSNRICLVERIGN
QGATYPEIDAVKACNSAGASGVIVYSNTDLPGLQNPFLVDTNNEAALVSVSVDRATGQAL
QGQIGSTVTVANTDNEDYEYYNGTSMATPHVSGVATLVWSHHTQCSAAQIRAALHATAED
LDAAGRDDKTGYGLVDAVAAKAYLDESCDGPTDPGTGPGDNVLVNGTAKTSLAGAKDAEL
HYSIDVPAGATDLSFTMSGGTGDADLYVQYGAAPTTGSYDCRPWKSGNSESCPISNVQTG
TYYVMVQGYSAFSGVSLVANYTESNGGGNPGGGAASYTNNTTYAIPDNRSAGISSAISAT
RTGDSGSVSVAVDISHTYIGDLQVELHSPSGQVAILHDNTGGSANDINKTYTVDMSGVES
AGQWTLKAVDSARRDTGTINSWTLSFQ
Download sequence
Identical sequences B1KLL5
gi|170727381|ref|YP_001761407.1| WP_012325648.1.77901 392500.Swoo_3041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]