SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 392500.Swoo_3876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  392500.Swoo_3876
Domain Number - Region: 22-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00326
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 392500.Swoo_3876
Sequence length 169
Comment (Shewanella woodyi ATCC 51908)
Sequence
MDRSFPEILKKLHEIEIDYADGEGIDFEPFDEFYSEEETSDWIKAWTGNDTLDGNEYLIY
GQDGTGGYVAFWCVRKNADLLEQPIVFFGSEGEVGVVAQSFSDYVWLFANGIGPYEAVAY
PDLERPKSQDFIRFATEYAPSSKSTASQIVEKAKAEFPDFEGIIDRLCQ
Download sequence
Identical sequences B1KFF9
392500.Swoo_3876 WP_012326464.1.77901 gi|170728203|ref|YP_001762229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]