SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 392500.Swoo_4094 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392500.Swoo_4094
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.46e-19
Family SMI1/KNR4-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 392500.Swoo_4094
Sequence length 186
Comment (Shewanella woodyi ATCC 51908)
Sequence
MSKDISELCAKIKWKPIDTDYGATKESYLSSNEELIAIERFLQAKLPDDYLWFMKNVGRR
LIDDRRINIKLNGVSLSFLDWFRDAIDVLTFTQMASEKEDKMQTSFNLVVISSSISHDEV
LLDVSAGHYGNIWFKHHNPKWRQKFSENPEGLVLIANSFTDLFSKIVNNHSPGEIDFNFD
DDDEII
Download sequence
Identical sequences B1KH38
WP_012326679.1.77901 gi|170728419|ref|YP_001762445.1| 392500.Swoo_4094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]