SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 393011.FTH_1487 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393011.FTH_1487
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-49
Family Ribonuclease PH domain 1-like 0.0000281
Further Details:      
 
Domain Number 2 Region: 300-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-44
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 3 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.88e-29
Family Ribonuclease PH domain 2-like 0.0000996
Further Details:      
 
Domain Number 4 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-26
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 558-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 6 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.06e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0022
Further Details:      
 
Domain Number 7 Region: 622-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000021
Family Cold shock DNA-binding domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 393011.FTH_1487
Sequence length 693
Comment (Francisella tularensis holarctica OSU18)
Sequence
MKIFREVFELGNKEIILETGGMARQADGSVTVSCGNNVVLVTTVVKKSVADGTDFFPLSV
HYLEKTYAAGKIPGGFLRREGRPSEEQILISRLIDRSIRPSFPDGFFNEIQIVATVLSYD
GAFSPDILALIGASASLAISGAPYDDVVAGVRVGYTNGKYILNPNKQDLRDSDLDLVVSG
TYDAILMVESEANSLPESVMLGGILYAHKHLKTIINSINRLAKVASKPRIEYSIYQINKF
LKSQIKSQFFGEIKNTYTIALKQERNLKLNAIRKNVLEYIFSSDVDGNEYTEKEILEAFH
DIEKDLVRSNILEGKPRIDGRCTETIRPINVKIGVLPGVHGSALFTRGETQALVVTTLGS
DRDAQLVESLDGIEKCRYMLHYNFPPYSVGECGMVGMAPKRREIGHANLAKRATQAVFPN
EEAYPYVVRVVSEILESNGSSSMATVCGSSLSMMDAGVPIAEPVAGIAMGLIKDGAKYAV
LSDILGDEDHLGDMDFKVAGTRYGVTALQMDIKIKGISREILEQALEQARVGRLHILGIM
NEVIKEHKEAVSDVAPQIHVMNINPAKIKDVVGRGGATVKGIVEKTGAQIDTSDSGEVKV
FAKDKKSMDMAVAMIEEIVAEVEEGQVYKGKIVKLLDSGVFVNLLGSQDGYLPFSEIEQA
GMKTNSLVEGQGLEVLVQNIDRGGRVKLSLVAR
Download sequence
Identical sequences A0A0B6E7Q9 Q0BKU1
gi|115315207|ref|YP_763930.1| WP_011648757.1.12700 WP_011648757.1.13715 WP_011648757.1.28031 WP_011648757.1.54961 WP_011648757.1.64987 WP_011648757.1.82216 393011.FTH_1487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]