SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 393595.ABO_1735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393595.ABO_1735
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.93e-39
Family SMI1/KNR4-like 0.00000942
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 393595.ABO_1735
Sequence length 135
Comment (Alcanivorax borkumensis SK2)
Sequence
MDDIVDMLRERHDGGLIALELPDEDRLVEIEEQLLISLPADYKAFLLSASDIVCGSLEPA
TVMDDYAHNFLPEMAANSWNQGLPRYLIPVCETPNGIYAMSQEGEVVLWQPEQGINEDEV
WGSIWQWAREVWLES
Download sequence
Identical sequences Q0VNR5
WP_011589016.1.14994 WP_011589016.1.41240 WP_011589016.1.66393 gi|110834596|ref|YP_693455.1| 393595.ABO_1735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]