SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394503.Ccel_0204 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394503.Ccel_0204
Domain Number 1 Region: 16-125
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.4e-22
Family N-utilization substance G protein NusG, N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 135-187
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000802
Family N-utilization substance G protein NusG, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 394503.Ccel_0204
Sequence length 188
Comment (Clostridium cellulolyticum H10)
Sequence
MKVTSDCVKKAVIGVHWYVLFVKSGREHRVEQYLKKIVGIDMINPFIPLHEFLFKISGTV
KRELKPLFPGYVFIESDMAGQEFIRKLYNKIYLLSDIVRILKYSDTEIAVRDSEKQMLLD
LCNNEHCIESSRGVIKGDRIYITNGPLRGRESIIKKVNRHKRQALVEMEFMGDKRLVSVA
LEIVEKVV
Download sequence
Identical sequences B8I511
394503.Ccel_0204 gi|220927662|ref|YP_002504571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]