SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394503.Ccel_0752 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394503.Ccel_0752
Domain Number 1 Region: 179-519
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.7e-66
Family beta-glycanases 0.0001
Further Details:      
 
Domain Number 2 Region: 510-575
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000981
Family Type I dockerin domain 0.0017
Further Details:      
 
Domain Number 3 Region: 62-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000204
Family F-box associated region, FBA 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 394503.Ccel_0752
Sequence length 577
Comment (Clostridium cellulolyticum H10)
Sequence
MDKNNFLKVFLVLALAALIPLIPAANVPANAMLEEGIKYEFENGVQKNAEIHTDYVGKTD
DGLTFDLSGATCSFIGQKGTSTSVNVDIDQTGLYELVVRYAQPYDKTKKVQYLNVNDSNQ
GEVSFPYTLSWREMSAGIVKLNKGTNNIEFEGYWGYTFFDYLIVKPADESITSLKVEKKL
VNPDATKEAKALMSYLVDMYGKHIISGQQELCGSHNYEESEAEFTYIKDKTGKMPALRGF
DFMNYRGNGLSWDDLCAERVIDWYKNKGGIPTVCWHWFSPANIGKKADNSFYTESTTFSI
SKALTPGTAENTALLNDIKTMSEKFKQLQDAGVPVLFRPLHEAEGGWFWWGAEGPENCVK
LYRLLFDKFTNEYNLNNIIWVWTSYTYDTSSKWYPGDDVVDILGYDKYNAKDGLPNGSAI
SSTFYNMVKLTNGKKLVTMSENDTIPQVSNLTNEMAGWLYFCPWYGWHLTGEQNNPVDWL
KQMYTSDYCITLDELPDLETYPFPSDGDIPTIMYGDLNEDKLIDAIDLALLKKCILENNQ
SLKSADVDGNGSVDAIDFVYMKKFLTGEISGFPASGK
Download sequence
Identical sequences Q0PRN0
394503.Ccel_0752 WP_015924297.1.84728 gi|220928201|ref|YP_002505110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]