SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394503.Ccel_1239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394503.Ccel_1239
Domain Number 1 Region: 312-616
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.47e-77
Family beta-glycanases 0.0011
Further Details:      
 
Domain Number 2 Region: 13-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.89e-46
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 815-943
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.12e-40
Family Family 6 carbohydrate binding module, CBM6 0.00023
Further Details:      
 
Domain Number 4 Region: 209-314
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.48e-22
Family beta-Galactosidase/glucuronidase domain 0.0028
Further Details:      
 
Domain Number 5 Region: 948-1012
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000108
Family Type I dockerin domain 0.0015
Further Details:      
 
Weak hits

Sequence:  394503.Ccel_1239
Domain Number - Region: 699-800
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00068
Family Invasin/intimin cell-adhesion fragments 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 394503.Ccel_1239
Sequence length 1015
Comment (Clostridium cellulolyticum H10)
Sequence
MLRKKILCIFLVTVLMLTILPIPQQTVMADTGVLKELKGTDIYNGLRGLNFNEGWKFNKG
DVSNGQSTGYNDSGWSGVTLPHDWSIYNTFNKSSAAGAGGGYLDGGIGWYRKTFTVPSDY
TGKKVFIEFDGAYMNSQVWINGTLLGTRPYGYSSFEYDLTPYLNIGGSNVIAVRLNNNQP
TSRWYSGSGIYRNVWLTVLDPVHVTYCGMFVTTPTVSSSSATANVSTKVLNQGSTAKSVS
LKTTITDAEGNVVATNTSSVASIAGSGSNTFSQNLTVSNPHLWSPASPYLYAVQTQVIVD
GNVTDTYSSTLGIRYFSFSSTSGFSLNGVNMKINGVCLHHDLGSLGAAVNYRAIERELQI
MKDMGCNAIRTSHNPPDPQMLEICDRLGLMVMDEAFDCWETGKNSNDYHLYFNNWAQTDL
QAMVTRDRNHPSIIMYSIGNEIPSPSVATATKLKNWVKDVDNTRPVTLGTFAVSMGDATP
QAVASVLDLVGYNYFPYMYDGGHNNHPEWKMFGSETSSAVRSRGVYKTPTNKNILTDSDN
QCSSYDNSVVSWGNSAESSYNEINKRNYMAGEFIWTGFDYIGEPTPYEWPAKSSYFGIVD
TCGFPKDIYYFYQSKWSTKPMVHILPHWNWSTGTNVEVWAYSNCDTVELFLNGKSLGSKS
VGTAGHLSWSVPWSSGTLRAKGTKGGTVVYDEVVTAGTPSKVLLKPDRTSVKADGKDLIY
IETDIADGNNVTVPTADNTVNFSISGPGVIVGVDNGNPISTEAYKGSSRKAFNGKCLVIV
QPTKVNGTIVVTASSNGLSSGSVSIASTGGAEAPIVSAYKKIEAENYDNQSGIQTEACSE
GGQDVGFIENGDYTVYNNVDFGSGAESFTARAASATSGGNIEIRLDSPNGTLIGTCPVAG
TGDWQTYADVNCSVSEVSGKHDLYLKFTGDSGYLFNINWFTFTARNSAKLGDLNSDDQID
AMDFQLMKKYLLGLGEIKDTKLADLDASGTIDVLDLMLLKQYLLGTITSFPGQGT
Download sequence
Identical sequences B8I0M0
WP_015924744.1.84728 gi|220928666|ref|YP_002505575.1| 394503.Ccel_1239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]