SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394503.Ccel_1298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394503.Ccel_1298
Domain Number 1 Region: 30-406
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.19e-107
Family Cellulases catalytic domain 0.0000000416
Further Details:      
 
Domain Number 2 Region: 413-475
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.83e-16
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 394503.Ccel_1298
Sequence length 477
Comment (Clostridium cellulolyticum H10)
Sequence
MKKFFACLLVLAIIVTIVPINIASAETGGYYATGNYRNVFVETGRTEAQVQDKMNTMFDK
FFKGDTNNQRLFYETGTDEAYIRDTGNGDVRSEGMSYGMMVCVQMDKKKEFDMLWKWARN
HMYQTSGQFKGFFAWQCNYDGGIIDSTPASDGDEYFAMALLFAARRWGNGTGIYNYEAEA
QTILDAMLHQSDDGVGYNMINKNANQVVFCPSAGNYDFTDPSYHLPAFYELWAMWGPERD
RATWSKVAATSREFLKKSTHPTTGLNPDYANFDGSAKEVSWSSGHGDFRFDAWRVIQNSC
VDYAWWQKDSWPATTFAPKIQAFFKNQGLSTYGNQYTLSGSKLSSDHSPGLVAMNAVSAL
ASDATTAKPFVDELWNTAVPSGQYRYYDGMLYMLGMLNVSGNFKIWGAPTEPSVTRGDIN
DDGTIDSVDFALLKSYLLGRTTTLPNMKAADLNGDGVVDAMDWAVLRQYLLGIIKTL
Download sequence
Identical sequences B8I0S8
394503.Ccel_1298 WP_015924801.1.84728 gi|220928724|ref|YP_002505633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]