SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394503.Ccel_2017 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394503.Ccel_2017
Domain Number 1 Region: 31-228
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.44e-17
Family YxiM C-terminal domain-like 0.066
Further Details:      
 
Domain Number 2 Region: 237-302
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000432
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 394503.Ccel_2017
Sequence length 303
Comment (Clostridium cellulolyticum H10)
Sequence
MKKLLLFSIIMAVMAASFTPATIFAATTQIKGSDVMIIGDSYFAMSGEITRALENEARNA
GVLGANDRFRDYTVSGSTLANNGIPSQYRNGINSGKVKYVIMDGGGNDCLQGYSAPPYTA
STPFIKNATDAVTDLLKQMKADGVVKVFYLFYPDPNGDLNGLKSKLDALRPIMQSTVANA
AQKPETYFFDIRPTWSGNLSQYTLPDGIHPTTAGSVATAKAMWAEMQKVNFFGTSTPTIK
YGDYNNDGSIDALDFSSFKMYLMNPVRTYTEVLDLNSDNTVDAIDFAIMKQYLLGIVKNL
PYK
Download sequence
Identical sequences B8I3M0
gi|220929434|ref|YP_002506343.1| WP_015925465.1.84728 394503.Ccel_2017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]