SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_5554 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_5554
Domain Number 1 Region: 60-157
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0000366
Family Bactericidal permeability-increasing protein, BPI 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_5554
Sequence length 159
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MRNCLGLLTAGVFLLQPCSFAKAQAPNALERAIGDVQPCRSLKTKVSSFGISVEVGVDKL
DSVKIENLQLSVNGDTAEASARGTLACKTSDEALVEGGFSATAEVRLKIDLSTCKTTDTS
IEIVKTGGRFGDVVKGLETQISGVLRQSLEKNLAKLCQK
Download sequence
Identical sequences C6B8Y2
395491.Rleg_5554 WP_012760308.1.14669 gi|241518293|ref|YP_002978921.1|NC_012853 gi|241518293|ref|YP_002978921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]