SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395495.Lcho_0341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395495.Lcho_0341
Domain Number 1 Region: 163-482
Classification Level Classification E-value
Superfamily Subtilisin-like 5.5e-74
Family Subtilases 0.00000301
Further Details:      
 
Domain Number 2 Region: 508-624
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000314
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395495.Lcho_0341
Sequence length 627
Comment (Leptothrix cholodnii SP 6)
Sequence
MNHKRESLRTNPWASTAADWAWGIAIGALLLAAGSSWSMARGDRRDVRAPTQATADEEGT
DRVIVKYRNADRSQIDPTTQGSVRVAGNRAGVRLSRLRGMAHGGHVLRADRRLSLAAAQR
LADDIRSGDAEVEYAEPDRIMTIQLVPNDPSYASQWNLFEATAGLNLPAAWDKSTGAGVV
VAVLDTGVRPHVDLAGNLLAGYDFINDTTVANDGNGRDADAFDPGDWAAAGACGSGSAAD
SSSWHGTHVAGTIAALTHNARGVAGVAFGARVLPVRVLGRCGGYTSDIADGMVWAAGGSI
TGVPANPTPARVINLSLGGSGACGTTTQNAINSARSRGAVVVVAAGNSAANAAGFSPAGC
AGVVTVAAVGRSGARASYSNYGTVVDVAAPGGDGSSGIQSTLNAGSSTPGADSYASYMGT
SMATPHVAGVVALMLARNPALTPDEVEARLKSSAAARGFPVACSQCGSGLLDANRAIDAA
IGSGTTTPAPTPAPAPTPTPAPTPSLTQVAEVESNHARSSAQAISANPAQVNATIGSTSD
TDYFRVTLAAGRTLVATLAPNAGSDYDLYAYNAAGTRVASSVLGTGAVDTVSVRNAGTGA
TTVYVRVLRYSGGTGATGGRYTLKLAQ
Download sequence
Identical sequences B1XW89
gi|171057032|ref|YP_001789381.1| 395495.Lcho_0341 WP_012345378.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]