SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395960.Rpal_3295 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395960.Rpal_3295
Domain Number 1 Region: 18-192
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-49
Family NQO2-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395960.Rpal_3295
Sequence length 249
Comment (Rhodopseudomonas palustris TIE 1)
Sequence
MSVRRLAPKELQPESFAFTAENLAWAQKEITKYPPGRQFSAVIAIMWRAQEQCGGWLPEA
AIRTVADMLQMPHIRALEVATFYTMFQLNPVGKKAHVQVCGTTPCRLRGAGELIEVCKNR
IHHDPFHLSADGDFSWEEVECAGACVNAPMVQIWKDTYEDLTPETLNKVLDGFASGNPPT
PGPQNGRQHAAPMTGPTTLKSGGINVSPVDSNGPALTDNDAKRAGAAANVQERPAPKPPA
ADATEKNPP
Download sequence
Identical sequences B3Q7N1 Q6N5M7
gi|39936012|ref|NP_948288.1| WP_011158496.1.13849 WP_011158496.1.60452 WP_011158496.1.81860 gi|192291667|ref|YP_001992272.1| 258594.RPA2947 395960.Rpal_3295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]