SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_0071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395962.Cyan8802_0071
Domain Number 1 Region: 590-688,726-740
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000681
Family HD domain 0.039
Further Details:      
 
Weak hits

Sequence:  395962.Cyan8802_0071
Domain Number - Region: 267-345
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.00569
Family TF C-terminus 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_0071
Sequence length 814
Comment (Cyanothece PCC 8802)
Sequence
MNTLQFLTEQLEKLRRSGENTRLSPLRNVDTSAKSSSATTNTSPNILQKLHCSSSLRKIH
PPLMWSLAVVSLTSVIGYRFYHQPKLAVGTVSPVTIIAPRDGIFEDIKTTEEKRKEVRTG
IIPVLQRDLELTSQLRLTLTETLAEIEGLRRMAGYFPIIAVQKIPSRTQQYLRVASEKEW
QVFRQYQGKVSSNIPNLNPNLNKAWADFQRYEQTVTKTEVNGLLAKFSESRQRYNQAKTK
IANIRSPYLTPNVMTAFLDLNQSSWEMTYKAIQNTANKILMQGLPVGMPDNLLEEIIQLH
LHSSLPASNEVIATKLLLSVLQGQHNLSIDKEETKQRAEQAAQAVEPVIVEIKRHDVIVK
AGQVITQKEFVLLDSFGLSRREINWLGLGVTVILVGGGVSIFCLINRRIHRPMRRRDHLL
LCLLSLSTPILAIFNLGYTNLPAIGLLTSSFYGPTLAVTQVLLLSGLSTFTSGTVNWSYI
LAGTAGGLLSACLAGKLRSRDELARLGGGVGIIQGAFYFAVYLSLTPVAGTIWSAVLPGA
IVYGLSGFLWSVMALGISPYLERLFDLVTPIRLVELANPNCPLLKRLSTETPGTFQHTLF
VACLAEAAARELHCNVELIRAGTLYHDIGKMHDPLGFIENQMGAPNKHDQINDPWKSVEI
IKKHVTEGLVMARKYGLPRVIRDFIPEHQGTLLISYFYYQAKQQAEKEGTAPISEEDFRY
AGPIPQSRETGIVMLADGCEAALRSLKEATPEAALGMINKIFKARWRDNQLTDCGIKYEE
LPIIADVFVKVWQQFHHQRIVYPKAALDTQATTK
Download sequence
Identical sequences B7K0M5
gi|257057989|ref|YP_003135877.1| gi|218244964|ref|YP_002370335.1| 395962.Cyan8802_0071 41431.PCC8801_0073 WP_012593456.1.62203 WP_012593456.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]