SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_2674 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395962.Cyan8802_2674
Domain Number 1 Region: 45-386
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-48
Family Filamentous hemagglutinin FhaB, secretion domain 0.0097
Further Details:      
 
Domain Number 2 Region: 405-467,495-525
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  395962.Cyan8802_2674
Domain Number - Region: 522-602
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000104
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Domain Number - Region: 625-696
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0879
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_2674
Sequence length 952
Comment (Cyanothece PCC 8802)
Sequence
MGDITLTTKILETIPNYPVMSASFYLTPHDLLATFLSISGLMVSPIASAQVASDGTVQTQ
VNTLGNQLEITEGTQAGSNLFHSFSQFSVPSGFEAYFNNSSTISNIISRVTGGSISNIEG
LIRANGTANLFLINPNGIVFGPNAVVDIGGSFLATTAESIQFADGSQFSATNSQSSPILT
IAVPVGLQFGSNPGTIVNRAHRTVPDPTPDNPNNTRQVGFEVKSGNTIALVGGDLDFQGG
RVNGSGGRVELGSVGGNSRVQLSVTNPGLEIDYQGVTNFQDISLSQQSIVDVNNSTIQVQ
GSNIRLTNGSQISSTTRTTEDAGDLTVNATESVELIGAAPEGFPFPSAFIAQVNPGGTGR
GGNLIINTKQLSIREGAGISVASQGEGIGGRLEVNVSEAIEITGTGRLFPSVLTSSTDGT
GDGGEIVINTRQLTLSNGGQIQAFTISQGRGGTITINASDSIEVSGRGALPEFNTESFSS
ITAESGFQLLGFTGIAPGGNVNINTNQLIVTDGGTISAGSFGQGNAGSVDITSNSIFLDN
QGVITASSEGSGDAGNITILTDQLSVNNQSEISVRNIGFGQGGNLTISADAISLNQDSQL
TAVSFPLEDLTLQELGINAEEFVNRPNIGNAGDLILNTSSLNLNNDSQVTVSSFGTGNAG
SMGITAQNIALDNSSELAAETASGEGGNISLYVSDFLNLRRASTISTTAGTLGGGGNGGN
IFIDAEFMVTVPTENSDIIANAFLGNGGNIRINASGVFGIEERERLTPLNDITASSQFGQ
VGSIGINRPDVDPQRSLVKLPGEVVDAKNLVVQACSPGGAYTRGEFSITGSGGLPVNPDE
GIQTSPGLTELGYPEIEMFNQSDNQESLKIPNESLTPDYKRQSSPTTIVEAQGWIMDKNG
KVVLTAQSPNVTPHGSGFMPSNCYDLSNRSLSSATSPSPSLSDVPQRNSLAE
Download sequence
Identical sequences WP_015784299.1.62203 395962.Cyan8802_2674 gi|257060481|ref|YP_003138369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]