SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_2837 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395962.Cyan8802_2837
Domain Number 1 Region: 65-209
Classification Level Classification E-value
Superfamily FtsH protease domain-like 7.32e-19
Family FtsH protease domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_2837
Sequence length 230
Comment (Cyanothece PCC 8802)
Sequence
MERTSLNLIAISVFVMTLSALLSPIFHISPFIPAVATLGILGLVSVDSLSWQSKGLTLVL
GLLSSPQERQRIIHHEAGHFLVAYCLGIPVTGYTLSAWEAFKQGQIGYGGVKFDLTLLSD
LKVQETPLIFERFFTVWMAGIAAERVIYGNAIGGEQDRQILREMMKLAGILPQNYQQKER
WAILQAKTLIEKHQDAYQSLGEMMAQGASVEDCYQGIQKKLSWQDKTEID
Download sequence
Identical sequences 395962.Cyan8802_2837 gi|257060634|ref|YP_003138522.1| WP_015784372.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]