SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_3968 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395962.Cyan8802_3968
Domain Number 1 Region: 1-57,105-196,225-375
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.06e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.001
Further Details:      
 
Domain Number 2 Region: 353-469
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.62e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_3968
Sequence length 476
Comment (Cyanothece PCC 8802)
Sequence
MSEQFDYDLVIIGAGVGGHGAAIHAVQCGLKTAIIEAKDMGGTCVNRGCIPSKALLAASG
RVRELRDTHHLNSLGIQVGGVNFQREAIADHATNLVNKIRGELTNSLKRLKVDTIHGWGK
ILDSQKVSVLTDNGEKIITAKDIMLCPGSVPFVPRGVEIDHKTVFTSDEAVKLETLPQWI
AIIGSGYIGLEFSDIYTALGCEVTMIEALDTLMPGFDPEISKLAERILLKTRDIETYSGV
FATKITPGSPVTIELTDAKTKEVLDVLEVDACLVATGRIPATKNLGLENLGIETQRGFIP
VNDRLEVLKDGEPVPHLWAVGDATGKMMLAHAASGQGVIAVENICGRDKTIDYRSIPAAA
FTHPEISYVGLTEPQARELGEQEGFTVASVKTYFKGNSKALAEGETDGIAKVVFRQDTGE
LLGVHIIGIHASDLIQEAANAIAQRQSVTHLAFNVHTHPTLSEVLDEAFKRAEVAV
Download sequence
Identical sequences 395962.Cyan8802_3968 WP_015784994.1.62203 gi|257061718|ref|YP_003139606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]