SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_4256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395962.Cyan8802_4256
Domain Number 1 Region: 110-279
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.55e-58
Family NadC C-terminal domain-like 0.000011
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.88e-27
Family NadC N-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_4256
Sequence length 282
Comment (Cyanothece PCC 8802)
Sequence
MLPPPIVLDPWLKLWLREDIGRGDRTTQGLSLHNTGEATWIAKESGIIAGLPIAGRVFQL
LSDRSEFTPLVQEGDRVQSGQVIINIKAPLDVLLMGERVALNLAMRLSGIATLTRQYTEM
IADLPTQLVDTRKTTPGLRILEKYATQMGGAINHRLGLDDAVMIKDNHIQADGSIQTAIT
QIRQRMPYPLTIEVETTNLLEVEEALNYGADIIMLDNMELGLIKQAVAIIRNSNPRVKIE
ASGNITLATIRAVAETGVDYISSSAPITRSPWLDLSMRISSK
Download sequence
Identical sequences B7K691
gi|218248929|ref|YP_002374300.1| 395962.Cyan8802_4256 41431.PCC8801_4217 gi|257061989|ref|YP_003139877.1| WP_015785192.1.62203 WP_015785192.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]