SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395963.Bind_0162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395963.Bind_0162
Domain Number 1 Region: 1-149,1078-1165
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000192
Family ABC transporter ATPase domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 851-964
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000892
Family Spectrin repeat 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395963.Bind_0162
Sequence length 1181
Comment (Beijerinckia indica ATCC 9039)
Sequence
MRLLSLSLERFGPFTDRLLTFREGAKLHLVHGPNEAGKSSSLAAIGDLLFGIPRKTRFAF
VHQERDLRLGATLLSREGLRFDFRRKPGGKGALIGADGNTLPDDALAPWLGGLSREVFGH
AFGLDAESLRANAEMLLDAEGDMGASLLAAASGLRGLVTLRQTLDDEADQIYGERKAQHR
LFYQALARYEEASEAIRKDELKADDWKTLNAEIERLGADRHSLKEQRVDLAREQARLERL
KRIAPLFDAIDGRMRQIEALGDLPEVPPGFARHIEDELNAAEAARKRLADLLGEKQRAEH
ELASIAIDIHLLDQAETISELFARTQAYAASRKDLPRVVSERDEKEAALRQCGASLGLTE
GILREDQQPSSAAIARVTHLIRKGRAAANEVESLRHNLRKEEDRQRDLLREKERLGVLSD
PAPLLEQMARLGAFETEIAKYTDLRQKIRAETQALDEAAARLQPRVTRLDDVVSRPLPSN
ATIQRFQTDFATLETEIRREEEKRGEALERAANAREELARLAGEGPVPSREAILAARGAR
EALWDKLRQDLLNPGTELQAARVETIAAFDRCRLEADDLADRAAGEAQRIAAHLRFTQSL
KDEERKADEAVHKLADQRARQQSLAETWGEAWAGSGLTPLMPAEMQAFAMQLNELLRRRE
GLLREHAAWTESEARLAVARPGLAALAKILNLEVLSLETVEAEDLANLYGRIGRLVQARK
DAWDGARDLAARERQFAESITDLRNAVLESERDHAVFATKWSEAVSAIGLRREALIEEAE
AALDVWRQAPALFEARNNRARRVEGMQRDQKLFESETVPLLADVAPDLAALPHDHAIKTL
HTRLVAMQKDQSRREECCKTLQRFEVEMSSAEKTLEQAEARLADHAASIGAARDDLAGLW
PRLAERESFQKEIEARKQQIHDLADGYAEADLRDELAASDRDRLDADLQALREEGERLVQ
KSNEIYASQERHLERRQKLEGGDGVQAEIALQRRRNAEAEMLAAARDYVVKKIGGKLIER
AITRAREERQSPLLRRASEIFAHLTGGDWAAIEQEFDADDKPHLVGRKSRETIRREDTKE
ESAGKAVPVIGMSEGTRDQLYLALRLAYLTDYAERAEAAPFIGDDLFASFDDVRTGHGLR
ALAAIGDLVQPILFTHHHHVVEIAKAALGDAVDVIELYQRS
Download sequence
Identical sequences B2IBU8
gi|182677163|ref|YP_001831309.1| 395963.Bind_0162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]